2 results for enfamil powder
- All
- Auction
- Buy It Now
- PFD 2 Amino Acid-Free Oral Supplement Unflavored 1 lb. Can Powder - 1 CountOpens in a new window or tabBrand New$25.54Free 2-3 day shippingFree returnsTop Rated Plusexpress_med (106,743) 99.6%
- Enfamil Poly-Vi-Sol w/Iron Liquid Multivitamin Infants/Toddlers 1.66oz *3 Pack*Opens in a new window or tabBrand New22 product ratings - Enfamil Poly-Vi-Sol w/Iron Liquid Multivitamin Infants/Toddlers 1.66oz *3 Pack*$52.66Free shipping5% off 3+ with couponbits_n-pieces (2,401) 96.7%
- Enfamil Vitamin A C & D DropsOpens in a new window or tabBrand New$9.00Free shippingdoubledeetreasures (72) 97.4%
- Tri-Vi-Sol Enfamil Vitamin Drops 50ml ^Opens in a new window or tabBrand New$16.95Free shippingFree returnsSave up to 10% when you buy moreTop Rated Plusswendyrx (112,808) 99.6%
- 3 Pack (50mL Each) Enfamil Poly Vi Sol Multivitamin w/ Iron Liquid EXP 7/24Opens in a new window or tabBrand New$19.99Free shippingSave up to 9% when you buy moreseark_deals (4,523) 99.7%
- Enfamil Fer In Sol Drops 50 Ml EachOpens in a new window or tabBrand New$29.18Free shippingFree returnsTop Rated Plusmr-medical (272,689) 99.8%
- Enfamil Poly-Vi-Sol Multivitamin & Iron Drops Brain & Body 6-24 monthsOpens in a new window or tabBrand New$9.99Free shippingSave up to 20% when you buy morebargaintree3 (191) 100%
- Enfamil FER-IN-SOL Iron Supplement Liquid Drops Gluten Free 50 ML• EXP : 12/24Opens in a new window or tabBrand New$14.95Free shippingtiffanyscosmetics (14,661) 99.4%
- Enfamil D-Vi-Sol Vitamin D Supplement Drops Infants 50ml 3/25 Strong BonesOpens in a new window or tabBrand New$7.99Free shippingbcmtreasures (525) 100%
- Enfamil POLY-VI-SOL Brain & Body Multivitamin & Iron Drops 6-24mo EXP 2/2024Opens in a new window or tabBrand New$9.21Free shippinggreatbuys4u2 (563) 99.2%
- 3 X Enfamil Poly-Vi-Sol Multi-Vitamins & Iron Drops Infants 50 ml Exp 06/24Opens in a new window or tabBrand New$14.99Free shippingFree returnsTop Rated Pluszeus-2128 (457) 99.8%
- Enfamil Fer In Sol Iron Supplement Blood Support Liquid Drops 50ml (2 Pack)Opens in a new window or tabBrand New$30.99Free shippingbestseller_shore (4) 100%
- Enfamil Tri Vi Sol Vitamin A C & D Supplement Gluten Free Liquid 50ml Pack of 6Opens in a new window or tabBrand New$84.65Free shippingFree returnsSave up to 5% when you buy moreTop Rated Plusluxepharmacy (98,095) 99%
- Enfamil Poly Vi Sol Multivitamin & Iron Supplement Immune Support 50ml Pack of 6Opens in a new window or tabBrand New$85.67Free shippingFree returnsSave up to 5% when you buy moreTop Rated Plusluxepharmacy (98,095) 99%
- Enfamil Poly Vi Sol Multivitamin & Iron Supplement Immune Support Liquid 50mlOpens in a new window or tabBrand New$19.21Free shippingFree returnsSave up to 15% when you buy moreluxepharmacy (98,095) 99%
- Enfamil POLY-VI-SOL Brain & Body Multivitamin & Iron Drops 6-24mo EXP 03/25Opens in a new window or tabBrand New$11.05Was: $13.0015% offFree shippingfloridapreppy (315) 97%
- POLY-VI-SOL IRON DROP 50ML by ENFAMILOpens in a new window or tabBrand New$17.43+$4.98 shippingvolfan37415 (30,559) 97.6%
- Enfamil POLY VI SOL Growth & Immune Health Multivitamin Drops NIB Exp 07/24 50mLOpens in a new window or tabBrand New$10.00+$4.38 shippingjaad7834 (8) 100%
- Enfamil Poly-Vi-Sol 8 Multi-Vitamins & Iron Drops for Infants 50 ml Exp 06/2024Opens in a new window or tabBrand New22 product ratings - Enfamil Poly-Vi-Sol 8 Multi-Vitamins & Iron Drops for Infants 50 ml Exp 06/2024$6.99+$5.90 shippingthegotoguys843 (842) 99.4%
- Enfamil Poly-Vi-Sol Liquid Multivitamin & Iron Drops Brain & Body, 50 mlOpens in a new window or tabBrand New$16.88Free shippingLast oneanaz_8473 (250) 97.9%
- Enfamil Tri Vi Sol Vitamin A C & D Supplement Gluten Free Liquid Bottle 50mlOpens in a new window or tabBrand New$18.56Free shippingFree returnsSave up to 15% when you buy moreluxepharmacy (98,095) 99%
- Enfamil Fer-in-Sol Iron Supplement Drops, for Infants and Toddlers - 50 MlOpens in a new window or tabBrand New$23.95Free shippingtphealthmartpharmacy (2,608) 99.1%
- 3 Pack Enfamil Drops Infants Multivitamin & Iron Drops Brain & Body Exp 08/2024Opens in a new window or tabBrand New$21.99Free shippingbigocollector (2,953) 99.7%
- Enfamil FER-IN-SOL Iron Supplement Liquid Drops Gluten Free 50 ML• EXP : 10/25Opens in a new window or tabBrand New$11.99+$5.80 shippingFree returnsTop Rated Plusthriftblaster (11,204) 100%
- Enfamil D-Vi-Sol For Infants Liquid Vit.D Supplement Gluten Free 1 2/3 Oz 6 PackOpens in a new window or tabBrand New$85.67Free shippingFree returnsSave up to 5% when you buy moreTop Rated Plusluxepharmacy (98,095) 99%
- Enfamil Breastfed Infant Probiotics & Vitamin D Dual Probiotics, 8.7mLOpens in a new window or tabBrand New$49.87Free shippingFree returnsSave up to 15% when you buy moreedkamall_21 (478) 89.6%
- Enfamil Poly Vi Sol Liquid Multivitamin Supplement 50ml Infant Oral 07/2024Opens in a new window or tabBrand New$7.99+$5.80 shippingfriendsandfamilymarket (119) 99.1%
- Enfamil D-Vi-Sol Vitamin Drops, Strong Bones 0-12 Months 0.25 Fl Oz Exp-1/25Opens in a new window or tabBrand New$6.94Was: $9.9230% off+$4.90 shippingFree returnsExtra 10% off with couponTop Rated Pluscheap-n-nerdy (988) 99.8%
- Enfamil Infant Probiotics & Vitamins B12 & D Baby 0-12M EXP 08/24 Lot of 3Opens in a new window or tabBrand New$15.00+$6.00 shippingLast oneonestopshop1531 (1,005) 99%
- Enfamil D-Vi-Sol Liquid Vitamin D Supplement for Infants 50 mL exp March 2024Opens in a new window or tabBrand New$9.99Free shippingblue_dragonfire1 (4,757) 99.6%
- Enfamil Prenatals & Baby Vitamin Tri-Vi-Sol VitaminA,C &D MultiVitamin Drop 50mlOpens in a new window or tabBrand New$9.99Free shippingLast onezzapiventures (203) 97.7%
- Enfamil D-Vi-Sol Vitamin D Supplement Drops for Infants exp: 03/2025Opens in a new window or tabBrand New$5.00+$4.38 shippinggoldenblock02 (337) 99%
- Enfamil Poly-Vi-Sol Liquid Multivitamin & Iron Drops Brain & Body, 50 mlOpens in a new window or tabBrand New$24.99Free shippingFree returnsSave up to 15% when you buy moreTop Rated Pluselusivesales (777) 100%
- Enfamil Baby Vitamin D-Vi-Sol Liquid Supplement Drops for Infants Distressed BoxOpens in a new window or tabBrand New$9.79Was: $10.8810% offFree shippingkingsoutlet (106) 94.2%
- 3 Pack (50mL Each) Enfamil Poly Vi Sol Multivitamin w/ Iron Liquid EXP 7/24Opens in a new window or tabBrand New$19.99+$1.25 shippingebhenezer19discount (71) 100%
- Enfamil Tri Vi Sol Vitamin A C & D Supplement Gluten Free Liquid Formula 50mlOpens in a new window or tabBrand New$19.04Free shippingFree returnsSave up to 15% when you buy moreluxepharmacy (98,095) 99%
- Enfamil Poly-Vi-Sol Multivitamin Supplement Drops with Iron for Infants ToddlersOpens in a new window or tabBrand New$16.66Free shippingFree returnsTop Rated Plusmr-medical (272,689) 99.8%
- Enfamil D-Vi-Sol Vitamin D Supplement Drops for Infants, 50 mLOpens in a new window or tabBrand New$12.00Free shippingmarisan-9236 (272) 99.5%
- POLY-VI-SOL Infant Multivitamin & Iron Drop 50ml by ENFAMIL EXP 7/2024Opens in a new window or tabBrand New$13.99Free shippingc24_net (793) 100%
- Enfamil Poly-Vi-Sol Multivitamin & Iron Drops Brain & Body 1 2/3 Oz (50 ml) 6-24Opens in a new window or tabBrand New$12.75Free shippingSave up to 20% when you buy morehalloffamesportscards (10,288) 97.7%
- Enfamil Iron Drops Active Minds Dietary Supplement Easy To Use DropperOpens in a new window or tabBrand New$9.99+$5.07 shippingSave up to 20% when you buy morevintique5450 (33) 100%
- Enfamil POLY-VI-SOL Multivitamin Supplement For Infant & Toddlers - 50mL NEWOpens in a new window or tabBrand New$12.99+$6.99 shippingFree returnsTop Rated Plusfredc23 (3,560) 98.4%
- Enfamil Vitamin AC & Drops Start Well 0-12 Months Dietary Supplement ( 3 Pack )Opens in a new window or tabBrand New$14.99Free shippingmagica_marketplace (221) 100%
- Enfamil Happy Tummy Dual Probiotic DropsOpens in a new window or tabBrand New$12.99+$5.13 shippinghous283 (2) 100%
- NIB LOT 3 Enfamil Breastfed Infant Probiotics & Vitamin D Dual Probiotics SealedOpens in a new window or tabBrand New$15.99Was: $19.9920% off+$6.05 shippingmvmcg-71 (242) 98.7%
- 6 Pack - Enfamil Tri-Vi-Sol Vitamin Drops - 50 ML EachOpens in a new window or tabBrand New$81.01Free shippingFree returnsTop Rated Plusmr-medical (272,689) 99.8%
- Enfamil Fer In Sol Iron Supplement Blood Support Liquid Drops Gluten Free 50mlOpens in a new window or tabBrand New$19.86Free shippingFree returnsSave up to 15% when you buy moreluxepharmacy (98,095) 99%
- Enfamil Baby Vitamin D-Vi-Sol Liquid Supplement Drops for Infants 50 Day SupplyOpens in a new window or tabBrand New10 product ratings - Enfamil Baby Vitamin D-Vi-Sol Liquid Supplement Drops for Infants 50 Day Supply$10.89Free shippingamazonessentials (1,077) 96.1%
- Enfamil D-Vi-Sol Vitamin D Supplement Drops for Infants, 50 mL Exp. 09/2024Opens in a new window or tabBrand New$11.50Free shippingSave up to 20% when you buy moreebid4less1 (22,189) 98.8%
- Enfamil D-Vi-Sol Vitamin Drops, Strong Bones 0-12 Months 0.25 Fl Oz Ex 03/2025Opens in a new window or tabBrand New$7.99Free shippingqandqcollectibles (18,734) 99.7%
- Enfamil iron drops active mind 0-24 months 50ml (3 pack)Opens in a new window or tabBrand New$45.00Free shippingclarissecohen (167) 98.8%
- Enfamil Tri-Vi-Sol Liquid Vitamin A,C&D Drops Supplement - 50ml EXP 5/2024Opens in a new window or tabBrand New$5.00+$5.25 shippingdealsbycase (1,691) 95.7%
- Enfamil D-Vi-Sol Vitamin Drops, Strong Bones 0-12 Months 0.25 Fl OzOpens in a new window or tabBrand New$7.90Free shippingkayla_dawns_closet (609) 98.9%
- Enfagrow NeuroPro Omega 3 DHA Prebiotics Non-GMO Toddler Nutritional Milk DrinkOpens in a new window or tabBrand New$29.66Free shippingccyesok (26) 100%
- FER IN SOL DROPS 50ML ESSENTIAL IRON FOR INFANTS & TODDLERSOpens in a new window or tabBrand New$17.81+$4.98 shippingvolfan37415 (30,559) 97.6%