1 result for enfamil infant formula
- All
- Auction
- Buy It Now
- Enfamil Tri Vi Sol Vitamin A C & D Supplement Gluten Free Liquid Formula 50mlOpens in a new window or tabBrand New$19.36Free shippingFree returnsSave up to 15% when you buy moreluxepharmacy (98,281) 99%
- Enfamil Poly-Vi-Sol w/Iron Liquid Multivitamin Infants/Toddlers 1.66oz *3 Pack*Opens in a new window or tabBrand New22 product ratings - Enfamil Poly-Vi-Sol w/Iron Liquid Multivitamin Infants/Toddlers 1.66oz *3 Pack*$52.66Free shipping5% off 3+ with couponbits_n-pieces (2,506) 96.8%
- Enfamil D-Vi-Sol For Infants Liquid Vit.D Supplement Gluten Free 1 2/3 Oz 6 PackOpens in a new window or tabBrand New$86.59Free shippingFree returnsSave up to 5% when you buy moreTop Rated Plusluxepharmacy (98,281) 99%
- 2pk Else Plant Based Complete Nutrition Formula for Toddlers 22 Oz Exp 06/2024Opens in a new window or tabBrand New$39.99Free shippingLast one2 watchersdaily.deals24seven (1,167) 98.9%
- Enfamil Poly-Vi-Sol Multivitamin & Iron Drops Brain & Body 1 2/3 Oz (50 ml) 6-24Opens in a new window or tabBrand New$12.75Free shippingSave up to 20% when you buy morehalloffamesportscards (10,309) 97.6%
- Enfamil Poly-Vi-Sol 8 Multi-Vitamins & Iron Drops for Infants 50 ml Exp 08/2024Opens in a new window or tabBrand New22 product ratings - Enfamil Poly-Vi-Sol 8 Multi-Vitamins & Iron Drops for Infants 50 ml Exp 08/2024$2.990 bids · Time left1h 27m left (Today 07:45 AM)+$5.80 shippingtsalesllc8 (243) 96.2%
- Enfamil® Poly Vi Sol® Multivitamin Drops - 50 mL BottleOpens in a new window or tabBrand New$17.47Free shippingversatco (153) 100%
- Enfamil Poly Vi Sol Liquid Multivitamin Supplement 50ml Infant Oral 07/2024Opens in a new window or tabBrand New$7.99+$5.80 shippingfriendsandfamilymarket (121) 99.1%
- 3 X Enfamil Poly-Vi-Sol Multi-Vitamins Iron Drops Infants Brain & Body Exp 10/24Opens in a new window or tabBrand New$18.00Was: $18.955% offFree shippingbeautiful_bargainz (62) 100%
- Enfamil Breastfed Infant Probiotics & Vitamin D Dual Probiotics, 8.7mLOpens in a new window or tabBrand New$49.87Free shippingFree returnsSave up to 15% when you buy moreedkamall_21 (479) 89.9%
- Enfamil Vitamin D Supplement Drops for Infants - 2 PackOpens in a new window or tabBrand New$39.99Free shippingFree returnsSave up to 5% when you buy moressnj2003 (4,360) 97.2%
- 12 EasyGo Protein Powder Dispenser Black / Green - also used for baby formulaOpens in a new window or tabBrand New$108.00Was: $120.0010% off+$21.25 shippinghemenwayhouse (3,870) 100%
- Enfamil D-Vi-Sol Vitamin D Supplement Drops Infants 50ml 3/25 Strong BonesOpens in a new window or tabBrand New$7.99Free shippingbcmtreasures (525) 100%
- Lot of 2 Packs Enfamil D Vi Sol Vitamin D For Breastfed Infant 50 Ml Exp 07/24Opens in a new window or tabBrand New$17.99Was: $19.9910% offFree 2-3 day shippingshhdonttell3167 (10,595) 99.6%
- Enfamil Poly Vi Sol Multivitamin & Iron Supplement Immune Support Liquid 50mlOpens in a new window or tabBrand New$19.36Free shippingFree returnsSave up to 15% when you buy moreluxepharmacy (98,281) 99%
- Enfamil Infant Probiotics & Vitamins B12 & D Baby 0-12M EXP 08/24 Lot of 3Opens in a new window or tabBrand New$15.00+$6.00 shippingLast one1 watchersonestopshop1531 (1,034) 98.8%
- Enfamil Baby Vitamin D-Vi-Sol Liquid Supplement Drops for Infants 50 Day SupplyOpens in a new window or tabBrand New10 product ratings - Enfamil Baby Vitamin D-Vi-Sol Liquid Supplement Drops for Infants 50 Day Supply$10.89Free shippingamazonessentials (1,080) 96.9%
- Enfamil Prenatals & Baby Vitamin Tri-Vi-Sol VitaminA,C &D MultiVitamin Drop 50mlOpens in a new window or tabBrand New$9.99Free shippingLast onezzapiventures (217) 97.4%
- Enfamil Fer-in-Sol Iron Supplement Drops, for Infants and Toddlers - 50 MlOpens in a new window or tabBrand New$23.95Free shippingtphealthmartpharmacy (2,616) 99.1%
- 3-pk Enfamil Baby Vitamin D-Vi-Sol Vitamin D Liquid Drops for Infants EXP: 08/24Opens in a new window or tabBrand New$21.89Free shippingFree returnspawsomedeals4less (129) 100%
- Enfamil Tri Vi Sol Vitamin A C & D Supplement Gluten Free Liquid Bottle 50mlOpens in a new window or tabBrand New$18.56Free shippingFree returnsSave up to 15% when you buy moreluxepharmacy (98,281) 99%
- 3 Pack Enfamil Drops Infants Multivitamin & Iron Drops Brain & Body Exp 08/2024Opens in a new window or tabBrand New$21.99Free 2-4 day shippingbigocollector (2,962) 99.6%
- Enfamil D-Vi-Sol Vitamin D Drops for Infants, Supports Strong Bone Health, 50 mLOpens in a new window or tabBrand New$30.09Free shippingFree returnsSave up to 15% when you buy moreedkamall_21 (479) 89.9%
- Else Plant-Based Complete Nutrition Formula for Toddlers Two 22 Oz CansOpens in a new window or tabBrand New$39.99+$5.00 shippingbobntina2020 (204) 96.5%
- Jarrow Formulas, Inc. Vegetarian Jarro-Dophilus Baby 3 Billion Cfu 2.1 oz PwdrOpens in a new window or tabBrand New$28.12Free shippingFree returnsTop Rated Plusswanson_vitamins (507,397) 99.4%
- Enfamil D-Vi-Sol Vitamin D Supplement Drops for Infants exp: 03/2025Opens in a new window or tabBrand New$5.00+$4.38 shippinggoldenblock02 (339) 99%
- Enfamil D-Vi-Sol Liquid Vitamin D Supplement for Infants 50 mL exp March 2024Opens in a new window or tabBrand New$9.99Free shippingblue_dragonfire1 (4,767) 99.6%
- Enfamil Poly-Vi-Sol 8 Multi-Vitamins & Iron Drops for Infants 50 ml Exp 06/2024Opens in a new window or tabBrand New22 product ratings - Enfamil Poly-Vi-Sol 8 Multi-Vitamins & Iron Drops for Infants 50 ml Exp 06/2024$5.94Was: $6.9915% off+$5.90 shippingthegotoguys843 (850) 100%
- Lot of 2 Packs Enfamil D Vi Sol Vitamin D For Breastfed Infant 50 Ml Exp 07/24Opens in a new window or tabBrand New$14.00Free shippingcraigkellogg26 (689) 99.2%
- Enfamil D-Vi-Sol Vitamin Drops, Strong Bones 0-12 Months 0.25 Fl Oz Ex 03/2025Opens in a new window or tabBrand New$7.99Free shippingqandqcollectibles (18,746) 99.7%
- INNATE Response Formulas Baby & Me 60 Multivitamin, Prenatal / Postnatal 4/2025Opens in a new window or tabBrand New$29.99+$3.99 shippingoffmarket2022 (394) 100%
- Else Plant-Based Complete Nutrition Formula for Toddlers 22 Oz Exp. 10/24 SealedOpens in a new window or tabBrand New$22.99Free shippingFree returnsTop Rated Plusnortheast-supply-solutions (654) 100%
- Enfamil D-Vi-Sol Vitamin D Supplement Drops for Infants, 50 mLOpens in a new window or tabBrand New$12.00Free shippingmarisan-923 (276) 99.5%
- Lot of 2 Packs Enfamil D Vi Sol Vitamin D For Breastfed Infant 50 Ml Exp 07/2025Opens in a new window or tabBrand New$17.00+$8.30 shippingsierra_summit_trading (1,160) 100%
- Enfagrow NeuroPro Omega 3 DHA Prebiotics Non-GMO Toddler Nutritional Milk DrinkOpens in a new window or tabBrand New$29.66Free shippingccyesok (29) 100%
- Enfamil Tri-Vi-Sol Liquid Vitamin A,C&D Drops Supplement - 50ml EXP 5/2024Opens in a new window or tabBrand New$5.00+$5.25 shippingdealsbycase (1,718) 98.3%
- Nestle NAN SUPREME Premium Starter Baby Infant Formula Powder 800gOpens in a new window or tabBrand New$26.08+$27.09 shippingfrom Australiaaozhoumama (18,961) 94.7%
- POLY-VI-SOL Infant Multivitamin & Iron Drop 50ml by ENFAMIL EXP 7/2024Opens in a new window or tabBrand New$13.99Free shippingc24_net (796) 100%
- Enfamil Baby Breastfed Infant Probiotics & Vitamin D Dual Probiotics EXP 1/2024Opens in a new window or tabBrand New$14.00+$5.25 shippingmatthelenhar-5 (32) 100%
- Enfamil Poly-Vi-Sol Multivitamin Supplement Drops with Iron for Infants ToddlersOpens in a new window or tabBrand New$16.66Free shippingFree returnsTop Rated Plusmr-medical (272,960) 99.8%
- Enfagrow NeuroPro Toddler Nutritional Drink, Omega-3 DHA, Prebiotics & Non-GMOOpens in a new window or tabBrand New$17.97Was: $18.925% offFree shippinglumbley9146 (81) 100%
- Physicians Formula 8-PC Murumuru Baby Butter Tropical Getaway Limited Ed SetOpens in a new window or tabBrand New$22.99Free shipping35 watcherspeter5168818 (3,773) 98.3%
- NIB LOT 3 Enfamil Breastfed Infant Probiotics & Vitamin D Dual Probiotics SealedOpens in a new window or tabBrand New$19.99+$6.05 shippingmvmcg-71 (243) 98.7%
- 100% Talc Free formula, All Natural Baby PowderOpens in a new window or tabHypo-Allergenic. Safe for infants, toddlers, childrenBrand New$13.95Free shipping24 soldsqueakycheeks (28) 100%
- Enfamil D-Vi-Sol Vitamin D Supplement Drops for Infants, 50 mL Exp. 09/2024Opens in a new window or tabBrand New$11.50Free shippingSave up to 20% when you buy moreebid4less1 (22,230) 98.8%
- Enfagrow NeuroPro Omega 3 DHA Prebiotics Non-GMO Toddler Nutritional Milk DrinkOpens in a new window or tabBrand New$28.37Was: $29.865% offFree shippinglumbley9146 (81) 100%
- 3X Enfamil Baby Vitamin D-Vi-Sol Vitamin D Liquid Supplement Drops for InfantsOpens in a new window or tabBrand New$43.95Free shippingdiscoveryhealth (10,590) 98.2%
- Enfamil D-Vi-Sol Vitamin D Drops for Infants - 50ml Exp 09/2024 Pack of 2Opens in a new window or tabBrand New$17.99Free shippingdirectdeals4_you (5,608) 99.2%
- Enfamil Prenatals & Baby Vitamins Tri-Vi-Sol Vitamin A, C & D Multi-Vitamin DropOpens in a new window or tabBrand New$9.99Free shippinghiddengems-usa (53) 100%
- FER IN SOL DROPS 50ML ESSENTIAL IRON FOR INFANTS & TODDLERSOpens in a new window or tabBrand New$17.81+$4.98 shippingvolfan37415 (30,622) 97.6%
- Baby Brezza Formula Pro Advanced Formula Dispenser FRP0046-A Used twice, No BoxOpens in a new window or tabNew other (see details)$80.000 bids · Time left2d 12h left (Wed, 06:24 PM)+$4.68 shippingzammuh22 (2) 75%
- **Enfamil Infant Probiotics & Vitamin D Baby 0-12 Months *NEW*Opens in a new window or tabBrand New$8.00+$5.80 shippingmarcellgline0 (178) 90%
- Enfamil Prenatals & Baby Vitamins Enfamil Enfamom Prenatal Vitamin & Mineral,Opens in a new window or tabBrand New$14.99+$4.43 shippingsard72278 (172) 100%
